ExsE (PA1711)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | ExsE | ||||||||
| Synonyms: | Not Available | ||||||||
| Gene Name: | exsE | ||||||||
| Enzyme Class: | Not Available | ||||||||
| Biological Properties | |||||||||
| General Function: | negative regulation of protein secretion, protein secretion by the type III secretion system, cellular response to calcium ion | ||||||||
| Specific Function: | chaperone binding | ||||||||
| Cellular Location: | Unknown | ||||||||
| KEGG Pathways: |
| ||||||||
| KEGG Reactions: | Not Available | ||||||||
| SMPDB Reactions: | Not Available | ||||||||
| PseudoCyc/BioCyc Reactions: |
| ||||||||
| Complex Reactions: | Not Available | ||||||||
| Transports: | Not Available | ||||||||
| Metabolites: | Not Available | ||||||||
| GO Classification: |
| ||||||||
| Gene Properties | |||||||||
| Locus tag: | PA1711 | ||||||||
| Strand: | + | ||||||||
| Entrez Gene ID: | 880941 | ||||||||
| Accession: | NP_250402.1 | ||||||||
| GI: | 15596908 | ||||||||
| Sequence start: | 1856308 | ||||||||
| Sequence End: | 1856553 | ||||||||
| Sequence Length: | 245 | ||||||||
| Gene Sequence: |
>PA1711 ATGAAAATCGAATCGATTTCGCCGGTGCAGCCGTCCCAAGACGCTGGAGCCGAGGCGGTGGGGCATTTCGAGGGGCGTTCGGTGACCCGCGCGGCCGTTCGCGGCGAGGACCGTTCCAGCGTGGCCGGGCTGGCGCGCTGGCTGGCGCGCAACGTGGCTGGCGATCCGCGTAGTGAGCAGGCCTTGCAGCGTCTCGCCGACGGTGACGGCACGCCGCTGGAGGCGCGCACGGTCCGGCGCAGGTGA | ||||||||
| Protein Properties | |||||||||
| Protein Residues: | 81 | ||||||||
| Protein Molecular Weight: | 8.7 kDa | ||||||||
| Protein Theoretical pI: | 11.01 | ||||||||
| Hydropathicity (GRAVY score): | -0.637 | ||||||||
| Charge at pH 7 (predicted): | 2.23 | ||||||||
| Protein Sequence: |
>PA1711 MKIESISPVQPSQDAGAEAVGHFEGRSVTRAAVRGEDRSSVAGLARWLARNVAGDPRSEQALQRLADGDGTPLEARTVRRR | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | PaperBLAST - Find papers about PA1711 and its homologs | ||||||||