Identification
Name: transcriptional regulator protein PcrR
Synonyms: Not Available
Gene Name: pcrR
Enzyme Class: Not Available
Biological Properties
General Function: regulation of transcription, DNA-templated, cellular response to calcium ion
Specific Function: Not Available
Cellular Location: Unknown
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Process
    regulation of transcription, DNA-templated
    cellular response to calcium ion
    Gene Properties
    Locus tag: PA1704
    Strand: +
    Entrez Gene ID: 879260
    Accession: NP_250395.1
    GI: 15596901
    Sequence start: 1851520
    Sequence End: 1851954
    Sequence Length: 434
    Gene Sequence:
    >PA1704
    GTGAGCGCCGATCCGCTGATTCCCTGGTTTCTCGCCCGCGGCCTGGCGGTGCGTCCGCATTGCCTGCGCGACACCTCGATCGCGCTCGGCTGGCAGGTCCTGGCCCATGGCTGCGAACTGGCCTGGCGCTGCGACGGCGAGCGGGTCTGGATCGTGATGTTGCGTCGGCGGCAGGCGCGCAGCGGATTGGCCAATCCATTCGCCGCGCTGTACCTGCTGGCGGAGGCCACGCTCGATACGCTGGGGCCGCGCCAGCGTCTCTACGGCAAGGTCCTGGCGCTGGCCGGCAGCCCACTGCCTGGCGAGCGCATGGCGCGCTTCTATCGCCGCTGGACCGGCGCCGCCGAGCCCGCCGACGGCTGGTTCGAGCTGGAGGCCGGGCGGGTGGTGACGCAGCGAAGCCTGCGAAAACGACAAAAACCCGACCGTGCCTGA
    Protein Properties
    Protein Residues: 144
    Protein Molecular Weight: 16.2 kDa
    Protein Theoretical pI: 11.23
    Hydropathicity (GRAVY score): -0.201
    Charge at pH 7 (predicted): 10.38
    Protein Sequence:
    >PA1704
    MSADPLIPWFLARGLAVRPHCLRDTSIALGWQVLAHGCELAWRCDGERVWIVMLRRRQARSGLANPFAALYLLAEATLDTLGPRQRLYGKVLALAGSPLPGERMARFYRRWTGAAEPADGWFELEAGRVVTQRSLRKRQKPDRA
    References
    External Links:
    Resource Link
    Genome ID: PA1704
    Entrez Gene ID: 879260
    NCBI Protein ID: 15596901
    General Reference: PaperBLAST - Find papers about PA1704 and its homologs