Identification
Name: Pcr1
Synonyms: pcr1
Gene Name: pcr1
Enzyme Class: Not Available
Biological Properties
General Function: negative regulation of protein secretion, protein secretion by the type III secretion system
Specific Function: protein binding, protein binding
Cellular Location: Extracellular
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Function
    protein binding
    protein binding
    Process
    negative regulation of protein secretion
    protein secretion by the type III secretion system
    Gene Properties
    Locus tag: PA1699
    Strand: +
    Entrez Gene ID: 877934
    Accession: NP_250390.1
    GI: 15596896
    Sequence start: 1848074
    Sequence End: 1848352
    Sequence Length: 278
    Gene Sequence:
    >PA1699
    ATGGCATACGGGCCTTCTGAATTGACCGGCGCAGTCATCGCCTTGCTCGAGAAGCGCTGGGTCGGCGTCGCCGAGGTGCAGGCGTTGCTCGAGCCGTTGCCGCTGGCCGACGTCGCCCGGCAGATCCATTTCTTCCGCGAACTGAAGCGTCTCTACCGCCTGTTGCCGGTCGAAGTGTTCGGCGACGACGAGCAGCGCCAGAATCTTTTGAATGCCTGCCAGATGGCACTCGACCTGGCGATCGAGCGCGAAGAGGAGCAGCAGCATGGACTGGGTTGA
    Protein Properties
    Protein Residues: 92
    Protein Molecular Weight: 10.4 kDa
    Protein Theoretical pI: 4.5
    Hydropathicity (GRAVY score): -0.077
    Charge at pH 7 (predicted): -5.56
    Protein Sequence:
    >PA1699
    MAYGPSELTGAVIALLEKRWVGVAEVQALLEPLPLADVARQIHFFRELKRLYRLLPVEVFGDDEQRQNLLNACQMALDLAIEREEEQQHGLG
    References
    External Links:
    Resource Link
    Genome ID: PA1699
    Entrez Gene ID: 877934
    NCBI Protein ID: 15596896
    General Reference: PaperBLAST - Find papers about PA1699 and its homologs