OrfX (PA1664)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | OrfX | ||||||||
| Synonyms: | Not Available | ||||||||
| Gene Name: | orfX | ||||||||
| Enzyme Class: | Not Available | ||||||||
| Biological Properties | |||||||||
| General Function: | protein secretion by the type VI secretion system | ||||||||
| Specific Function: | Not Available | ||||||||
| Cellular Location: | Unknown | ||||||||
| KEGG Pathways: |
| ||||||||
| KEGG Reactions: | Not Available | ||||||||
| SMPDB Reactions: | Not Available | ||||||||
| PseudoCyc/BioCyc Reactions: |
| ||||||||
| Complex Reactions: | Not Available | ||||||||
| Transports: | Not Available | ||||||||
| Metabolites: | Not Available | ||||||||
| GO Classification: |
| ||||||||
| Gene Properties | |||||||||
| Locus tag: | PA1664 | ||||||||
| Strand: | + | ||||||||
| Entrez Gene ID: | 880635 | ||||||||
| Accession: | NP_250355.1 | ||||||||
| GI: | 15596861 | ||||||||
| Sequence start: | 1814995 | ||||||||
| Sequence End: | 1815135 | ||||||||
| Sequence Length: | 140 | ||||||||
| Gene Sequence: |
>PA1664 ATGCCTGTTCGTCACTGGCCCGCCGTGCTTCTGGCCCTGGCCGTCCTCTGCGGCCTCGCCGGTTGCAGCGGCAACTACAAATTCAACGACGGCGACTATCGCCCGCTTGGCGATCCGCAGGCGGTCAATCGCGGCAAGTGA | ||||||||
| Protein Properties | |||||||||
| Protein Residues: | 46 | ||||||||
| Protein Molecular Weight: | 4.9 kDa | ||||||||
| Protein Theoretical pI: | 8.77 | ||||||||
| Hydropathicity (GRAVY score): | -0.083 | ||||||||
| Charge at pH 7 (predicted): | 2.16 | ||||||||
| Protein Sequence: |
>PA1664 MPVRHWPAVLLALAVLCGLAGCSGNYKFNDGDYRPLGDPQAVNRGK | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | PaperBLAST - Find papers about PA1664 and its homologs | ||||||||