Identification
Name: transcriptional regulator Anr
Synonyms: Not Available
Gene Name: anr
Enzyme Class: Not Available
Biological Properties
General Function: regulation of transcription, DNA-templated, regulation of arginine catabolic process, positive regulation of oxidoreductase activity, cellular response to decreased oxygen levels, cyanide biosynthetic process, negative regulation of phospholipase C activity, regulation of transcription, DNA-templated, regulation of transcription, DNA-templated, response to decreased oxygen levels
Specific Function: transcription regulatory region DNA binding, sequence-specific DNA binding transcription factor activity, DNA binding
Cellular Location: Cytoplasmic
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Component
    intracellular
    Function
    transcription regulatory region DNA binding
    sequence-specific DNA binding transcription factor activity
    DNA binding
    Process
    regulation of transcription, DNA-templated
    regulation of arginine catabolic process
    positive regulation of oxidoreductase activity
    cellular response to decreased oxygen levels
    cyanide biosynthetic process
    negative regulation of phospholipase C activity
    regulation of transcription, DNA-templated
    regulation of transcription, DNA-templated
    response to decreased oxygen levels
    Gene Properties
    Locus tag: PA1544
    Strand: -
    Entrez Gene ID: 883009
    Accession: NP_250235.1
    GI: 15596741
    Sequence start: 1681071
    Sequence End: 1681805
    Sequence Length: 734
    Gene Sequence:
    >PA1544
    ATGGCCGAAACCATCAAGGTGCGCGCACTGCCCCAAGCACACTGCAAGGATTGCAGTCTGGCCCCGCTGTGCCTCCCCCTGTCGCTGACCGTGGAAGACATGGATTCGCTGGACGAGATCGTCAAGCGCGGTCGTCCCCTGAAGAAAGGCGAATTCCTGTTCCGCCAGGGTGATCCTTTCGGCTCGGTCTTTGCCGTGCGCTCCGGCGCCCTGAAAACCTTCAGCATCACCGATGCCGGCGAAGAGCAGATCACCGGCTTCCACCTGCCCAGCGAGCTGGTCGGCCTGTCCGGGATGGATACCGAGACCTATCCGGTATCCGCCCAGGCCCTGGAAACCACCTCGGTCTGCGAGATTCCCTTCGAGCGCCTGGACGAACTGTCCGAGCAGCTGCCGCAGCTGCGCCGTCAACTGATGCGTCTGATGAGCCGGGAAATCCGCGATGACCAGCAGATGATGCTGCTGCTGTCGAAGAAGACTGCCGACGAGCGCATCGCCACCTTCCTGGTCAACCTGTCGGCGCGCTTCCGTGCCCGTGGCTTCTCCGCCCAGCAGTTCCGCCTGGCCATGTCGCGCAACGAGATCGGCAACTATCTCGGCCTGGCCGTGGAAACCGTGTCGCGGGTCTTCACCCGCTTCCAGCAGAACGGCCTGATCAGCGCGGAAGGCAAGGAAGTGCACATCCTCGACTCCATCGAGCTGTGCGCCCTCGCCGGCGGCCAGCTGGAAGGCTGA
    Protein Properties
    Protein Residues: 244
    Protein Molecular Weight: 27.1 kDa
    Protein Theoretical pI: 5.2
    Hydropathicity (GRAVY score): -0.119
    Charge at pH 7 (predicted): -4.42
    Protein Sequence:
    >PA1544
    MAETIKVRALPQAHCKDCSLAPLCLPLSLTVEDMDSLDEIVKRGRPLKKGEFLFRQGDPFGSVFAVRSGALKTFSITDAGEEQITGFHLPSELVGLSGMDTETYPVSAQALETTSVCEIPFERLDELSEQLPQLRRQLMRLMSREIRDDQQMMLLLSKKTADERIATFLVNLSARFRARGFSAQQFRLAMSRNEIGNYLGLAVETVSRVFTRFQQNGLISAEGKEVHILDSIELCALAGGQLEG
    References
    External Links:
    Resource Link
    Genome ID: PA1544
    Entrez Gene ID: 883009
    NCBI Protein ID: 15596741
    General Reference: PaperBLAST - Find papers about PA1544 and its homologs