
cytochrome C-type biogenesis protein CcmH (PA1482)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | cytochrome C-type biogenesis protein CcmH | ||||||||
| Synonyms: | cycL; ccl2 | ||||||||
| Gene Name: | ccmH | ||||||||
| Enzyme Class: | Not Available | ||||||||
| Biological Properties | |||||||||
| General Function: | generation of precursor metabolites and energy, cytochrome complex assembly | ||||||||
| Specific Function: | Not Available | ||||||||
| Cellular Location: | Cytoplasmic Membrane | ||||||||
| KEGG Pathways: |
| ||||||||
| KEGG Reactions: | Not Available | ||||||||
| SMPDB Reactions: | Not Available | ||||||||
| PseudoCyc/BioCyc Reactions: |
| ||||||||
| Complex Reactions: | Not Available | ||||||||
| Transports: | Not Available | ||||||||
| Metabolites: | Not Available | ||||||||
| GO Classification: |
| ||||||||
| Gene Properties | |||||||||
| Locus tag: | PA1482 | ||||||||
| Strand: | + | ||||||||
| Entrez Gene ID: | 881029 | ||||||||
| Accession: | NP_250173.1 | ||||||||
| GI: | 15596679 | ||||||||
| Sequence start: | 1607604 | ||||||||
| Sequence End: | 1608071 | ||||||||
| Sequence Length: | 467 | ||||||||
| Gene Sequence: |
>PA1482 ATGAAGCGTTTCCTCGCCACCGCGCTGCTCGGTCTCGCCCTCTGCGGCGTGGCCCGGGCCGCCATCGACACCTACGAGTTCGCCAGCGACGCCGAGCGCGAACGCTTCCGCAACCTGACCCAGGAACTGCGCTGCCCGAAGTGCCAGAACCAGGACATCGCCGACTCCAACGCACCGATCGCCGCCGACCTGCGCAAGCAGATCTACGGCCAGTTGCAGCAGGGCAAGAGCGACGGCGAGATCGTCGACTACATGGTTGCCCGCTACGGTGATTTCGTTCGCTACAAGCCGCCGGTCAACGAGCGTACCTGGCTGCTCTGGTTCGGTCCGGGCGCCTTGCTGCTGTTCGGCGTGCTGGTGATCGGCGTGATCGTCCTGCGCCGCCGGCGCACCGCTGCCAAGGTGCAAACCACCCTGTCCGCCGAGGAGCAAGCGCGCCTCGCCAACCTGTTGAAGAACGACAAATGA | ||||||||
| Protein Properties | |||||||||
| Protein Residues: | 155 | ||||||||
| Protein Molecular Weight: | 17.4 kDa | ||||||||
| Protein Theoretical pI: | 9.75 | ||||||||
| Hydropathicity (GRAVY score): | -0.176 | ||||||||
| Charge at pH 7 (predicted): | 5.9 | ||||||||
| Protein Sequence: |
>PA1482 MKRFLATALLGLALCGVARAAIDTYEFASDAERERFRNLTQELRCPKCQNQDIADSNAPIAADLRKQIYGQLQQGKSDGEIVDYMVARYGDFVRYKPPVNERTWLLWFGPGALLLFGVLVIGVIVLRRRRTAAKVQTTLSAEEQARLANLLKNDK | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | PaperBLAST - Find papers about PA1482 and its homologs | ||||||||