two-component response regulator CheY regulatory component of sensory transduction system for chemotaxis (PA1456)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | two-component response regulator CheY regulatory component of sensory transduction system for chemotaxis | ||||||||
| Synonyms: | Not Available | ||||||||
| Gene Name: | cheY | ||||||||
| Enzyme Class: | Not Available | ||||||||
| Biological Properties | |||||||||
| General Function: | phosphorelay signal transduction system, regulation of chemotaxis, positive regulation of single-species biofilm formation | ||||||||
| Specific Function: | phosphorelay response regulator activity | ||||||||
| Cellular Location: | Cytoplasmic | ||||||||
| KEGG Pathways: |
| ||||||||
| KEGG Reactions: | Not Available | ||||||||
| SMPDB Reactions: | Not Available | ||||||||
| PseudoCyc/BioCyc Reactions: |
| ||||||||
| Complex Reactions: | Not Available | ||||||||
| Transports: | Not Available | ||||||||
| Metabolites: | Not Available | ||||||||
| GO Classification: |
| ||||||||
| Gene Properties | |||||||||
| Locus tag: | PA1456 | ||||||||
| Strand: | + | ||||||||
| Entrez Gene ID: | 882097 | ||||||||
| Accession: | NP_250147.1 | ||||||||
| GI: | 15596653 | ||||||||
| Sequence start: | 1585640 | ||||||||
| Sequence End: | 1586014 | ||||||||
| Sequence Length: | 374 | ||||||||
| Gene Sequence: |
>PA1456 ATGAAAATTCTCATCGTGGACGACTTTTCCACGATGAGACGCATCATCAAGAACCTCTTGCGGGACTTGGGCTTCACCAATACCGCCGAGGCCGACGACGGCACCACGGCGCTGCCGATGCTGCACAGCGGCAATTTCGACTTTCTCGTCACCGACTGGAACATGCCGGGCATGACCGGCATCGATCTGCTGCGCGCGGTTCGCGCCGACGAGCGCCTCAAGCACCTGCCGGTGCTGATGGTCACCGCCGAGGCCAAGCGCGACCAGATCATCGAAGCGGCCCAGGCCGGGGTCAACGGCTATGTGGTCAAACCCTTCACCGCTCAGGTCCTGAAGGAAAAGATCGAGAAGATTTTCGAGCGGGTCAACGGCTGA | ||||||||
| Protein Properties | |||||||||
| Protein Residues: | 124 | ||||||||
| Protein Molecular Weight: | 13.9 kDa | ||||||||
| Protein Theoretical pI: | 6.54 | ||||||||
| Hydropathicity (GRAVY score): | -0.035 | ||||||||
| Charge at pH 7 (predicted): | -0.53 | ||||||||
| Protein Sequence: |
>PA1456 MKILIVDDFSTMRRIIKNLLRDLGFTNTAEADDGTTALPMLHSGNFDFLVTDWNMPGMTGIDLLRAVRADERLKHLPVLMVTAEAKRDQIIEAAQAGVNGYVVKPFTAQVLKEKIEKIFERVNG | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | PaperBLAST - Find papers about PA1456 and its homologs | ||||||||