
two-component response regulator CheY regulatory component of sensory transduction system for chemotaxis (PA1456)
Identification | |||||||||
---|---|---|---|---|---|---|---|---|---|
Name: | two-component response regulator CheY regulatory component of sensory transduction system for chemotaxis | ||||||||
Synonyms: | Not Available | ||||||||
Gene Name: | cheY | ||||||||
Enzyme Class: | Not Available | ||||||||
Biological Properties | |||||||||
General Function: | phosphorelay signal transduction system, regulation of chemotaxis, positive regulation of single-species biofilm formation | ||||||||
Specific Function: | phosphorelay response regulator activity | ||||||||
Cellular Location: | Cytoplasmic | ||||||||
KEGG Pathways: |
| ||||||||
KEGG Reactions: | Not Available | ||||||||
SMPDB Reactions: | Not Available | ||||||||
PseudoCyc/BioCyc Reactions: |
| ||||||||
Complex Reactions: | Not Available | ||||||||
Transports: | Not Available | ||||||||
Metabolites: | Not Available | ||||||||
GO Classification: |
| ||||||||
Gene Properties | |||||||||
Locus tag: | PA1456 | ||||||||
Strand: | + | ||||||||
Entrez Gene ID: | 882097 | ||||||||
Accession: | NP_250147.1 | ||||||||
GI: | 15596653 | ||||||||
Sequence start: | 1585640 | ||||||||
Sequence End: | 1586014 | ||||||||
Sequence Length: | 374 | ||||||||
Gene Sequence: |
>PA1456 ATGAAAATTCTCATCGTGGACGACTTTTCCACGATGAGACGCATCATCAAGAACCTCTTGCGGGACTTGGGCTTCACCAATACCGCCGAGGCCGACGACGGCACCACGGCGCTGCCGATGCTGCACAGCGGCAATTTCGACTTTCTCGTCACCGACTGGAACATGCCGGGCATGACCGGCATCGATCTGCTGCGCGCGGTTCGCGCCGACGAGCGCCTCAAGCACCTGCCGGTGCTGATGGTCACCGCCGAGGCCAAGCGCGACCAGATCATCGAAGCGGCCCAGGCCGGGGTCAACGGCTATGTGGTCAAACCCTTCACCGCTCAGGTCCTGAAGGAAAAGATCGAGAAGATTTTCGAGCGGGTCAACGGCTGA | ||||||||
Protein Properties | |||||||||
Protein Residues: | 124 | ||||||||
Protein Molecular Weight: | 13.9 kDa | ||||||||
Protein Theoretical pI: | 6.54 | ||||||||
Hydropathicity (GRAVY score): | -0.035 | ||||||||
Charge at pH 7 (predicted): | -0.53 | ||||||||
Protein Sequence: |
>PA1456 MKILIVDDFSTMRRIIKNLLRDLGFTNTAEADDGTTALPMLHSGNFDFLVTDWNMPGMTGIDLLRAVRADERLKHLPVLMVTAEAKRDQIIEAAQAGVNGYVVKPFTAQVLKEKIEKIFERVNG | ||||||||
References | |||||||||
External Links: |
| ||||||||
General Reference: | PaperBLAST - Find papers about PA1456 and its homologs |