Identification
Name: flagellar biosynthetic protein FliQ
Synonyms: Not Available
Gene Name: fliQ
Enzyme Class: Not Available
Biological Properties
General Function: protein secretion
Specific Function: Not Available
Cellular Location: Cytoplasmic Membrane
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Component
    integral component of membrane
    bacterial-type flagellum
    Process
    protein secretion
    Gene Properties
    Locus tag: PA1447
    Strand: +
    Entrez Gene ID: 881853
    Accession: NP_250138.1
    GI: 15596644
    Sequence start: 1575290
    Sequence End: 1575559
    Sequence Length: 269
    Gene Sequence:
    >PA1447
    ATGACCCCTGAGGTGGCACTCGACCTGTTCCGCGAGGCGTTGTGGCTGACGGCGATGATCGTCGGCGTGCTGGTGGTTCCGAGCCTGCTGGTCGGTCTCGTGGTGGCGATGTTCCAGGCCGCCACCCAGATCAACGAACAGACCCTGAGCTTCCTGCCGCGCCTGATGGTGATCCTGCTCACCCTGATCGTGCTGGGCCCCTGGCTGCTGCGGCAGCTGATGGAATACACCCAGACGCTGATCGGCAACATCCCGCTGCTGATCGGCTGA
    Protein Properties
    Protein Residues: 89
    Protein Molecular Weight: 9.9 kDa
    Protein Theoretical pI: 4.3
    Hydropathicity (GRAVY score): 1.201
    Charge at pH 7 (predicted): -2.02
    Protein Sequence:
    >PA1447
    MTPEVALDLFREALWLTAMIVGVLVVPSLLVGLVVAMFQAATQINEQTLSFLPRLMVILLTLIVLGPWLLRQLMEYTQTLIGNIPLLIG
    References
    External Links:
    Resource Link
    Genome ID: PA1447
    Entrez Gene ID: 881853
    NCBI Protein ID: 15596644
    General Reference: PaperBLAST - Find papers about PA1447 and its homologs