Identification
Name: flagellar protein FliO
Synonyms: Not Available
Gene Name: fliO
Enzyme Class: Not Available
Biological Properties
General Function: movement of cell or subcellular component, chemotaxis, response to stimulus, bacterial-type flagellum organization
Specific Function: Not Available
Cellular Location: Cytoplasmic Membrane
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Component
    integral component of membrane
    Process
    movement of cell or subcellular component
    chemotaxis
    response to stimulus
    bacterial-type flagellum organization
    Gene Properties
    Locus tag: PA1445
    Strand: +
    Entrez Gene ID: 881854
    Accession: NP_250136.1
    GI: 15596642
    Sequence start: 1574026
    Sequence End: 1574478
    Sequence Length: 452
    Gene Sequence:
    >PA1445
    ATGCGTCGCTACCTGTTCGCCGGCTTCCTGCCGGCACTCGCCTCGCTGAGCGCGCCGCTGTGCGCCGCCGAGGGGACGACGGGTGCCGCCGCGCCGACGGTGGGCGCCGCTTCCGGCGCCGCCGCGCAACTGGCCCAACTGGTGCTCGGCCTGGGCCTGGTGATCGGCCTGATCTTCCTGCTCGCCTGGCTGGTGCGCCGGGTGCAACAGGCCGGTCCGCGCGGCAACCGCTTGATCCGCACCCTTGCCAGCCAGCCGCTGGGTCCGCGCGACCGGCTGGTGCTGGTGCAGGTCGGTGAGGAGCAGATCCTGCTCGGCCTGACGCCCGGCCGGATCACGCCGTTGCACGTGCTCAAGGAGCCGGTACACCTGCCGGACGGCGAGCCGGCCACGCCGGAATTCGCCCAGCGCCTGCTGGAGCTGCTGAACAAGGACCCCAAGGGCAAGCCATGA
    Protein Properties
    Protein Residues: 150
    Protein Molecular Weight: 15.8 kDa
    Protein Theoretical pI: 10.79
    Hydropathicity (GRAVY score): 0.305
    Charge at pH 7 (predicted): 5.44
    Protein Sequence:
    >PA1445
    MRRYLFAGFLPALASLSAPLCAAEGTTGAAAPTVGAASGAAAQLAQLVLGLGLVIGLIFLLAWLVRRVQQAGPRGNRLIRTLASQPLGPRDRLVLVQVGEEQILLGLTPGRITPLHVLKEPVHLPDGEPATPEFAQRLLELLNKDPKGKP
    References
    External Links:
    Resource Link
    Genome ID: PA1445
    Entrez Gene ID: 881854
    NCBI Protein ID: 15596642
    General Reference: PaperBLAST - Find papers about PA1445 and its homologs