regulatory protein RsaL (PA1431)

Identification
Name: regulatory protein RsaL
Synonyms: Not Available
Gene Name: rsaL
Enzyme Class: Not Available
Biological Properties
General Function: quorum sensing, regulation of transcription, DNA-templated, negative regulation of secondary metabolite biosynthetic process, negative regulation of elastin catabolic process, negative regulation of cytolysis in other organism, negative regulation of cell motility, positive regulation of single-species biofilm formation
Specific Function: DNA binding
Cellular Location: Unknown
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Function
    DNA binding
    Process
    quorum sensing
    regulation of transcription, DNA-templated
    negative regulation of secondary metabolite biosynthetic process
    negative regulation of elastin catabolic process
    negative regulation of cytolysis in other organism
    negative regulation of cell motility
    positive regulation of single-species biofilm formation
    Gene Properties
    Locus tag: PA1431
    Strand: -
    Entrez Gene ID: 881782
    Accession: NP_250122.1
    GI: 15596628
    Sequence start: 1558880
    Sequence End: 1559122
    Sequence Length: 242
    Gene Sequence: 
    >PA1431
ATGGCTTCACACGAGAGAACACAGCCCCAAAACATGGCCTTCCGGGCAAAGGCCACCCGCACCGCCCGACGGGAAAGCCAGGAAACTTTCTGGAGCCGCTTCGGGATAAGCCAATCCTGCGGCAGTCGTTTCGAGAATGGCGAGAACCTGCCCTTCCCTATATATCTGCTTTTGCATTTCTATATAGAAGGGCAAATTACCGATCGCCAGCTCGCCGACCTGAGAGGCAAGATCAGAGAGTAA
    Protein Properties
    Protein Residues: 80
    Protein Molecular Weight: 9.4 kDa
    Protein Theoretical pI: 9.93
    Hydropathicity (GRAVY score): -0.77
    Charge at pH 7 (predicted): 3.43
    Protein Sequence: 
    >PA1431
MASHERTQPQNMAFRAKATRTARRESQETFWSRFGISQSCGSRFENGENLPFPIYLLLHFYIEGQITDRQLADLRGKIRE
    References
    External Links:
    Resource Link
    Genome ID: PA1431
    Entrez Gene ID: 881782
    NCBI Protein ID: 15596628
    General Reference: PaperBLAST - Find papers about PA1431 and its homologs