signal peptidase (PA1303)

Identification
Name: signal peptidase
Synonyms: Not Available
Gene Name: Not Available
Enzyme Class: Not Available
Biological Properties
General Function: negative regulation of proteolysis, regulation of cell motility, negative regulation of lipid biosynthetic process, regulation of secondary metabolite biosynthetic process, proteolysis
Specific Function: peptidase activity, serine-type peptidase activity
Cellular Location: Cytoplasmic Membrane
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Component
    integral component of membrane
    membrane
    Function
    peptidase activity
    serine-type peptidase activity
    Process
    negative regulation of proteolysis
    regulation of cell motility
    negative regulation of lipid biosynthetic process
    regulation of secondary metabolite biosynthetic process
    proteolysis
    Gene Properties
    Locus tag: PA1303
    Strand: -
    Entrez Gene ID: 881561
    Accession: NP_249994.1
    GI: 15596500
    Sequence start: 1414147
    Sequence End: 1414686
    Sequence Length: 539
    Gene Sequence: 
    >PA1303
ATGGGCCTGCTCGCCGCGATCATGCTGGCCGTCTACCTGGCGAATCCGTTCGGCACCGCCAGTCTCGACCCGCGCGCACGGCTCCTCGGCGTGGCGCTGTACAAGATCCCTTCGCGCTCGATGGAACCGACCTTGCAACAGGGCGACTTCATCCTCGCCAACGCCGCGCGCTACGCCTTCGCCGACCCGCAGGTCGGCGACCTGGTGGTGTTCCGCTTCCCGCCGCAGCGCAGCATCGCCTATGTGAAGCGCATCGCCGGGATACCCGGCGATCGCGTGCGGATCGATGGCGGCCGGCTCTACGTCAATGAGCGCCCGGTGACGGAGCCCTACCTGGCGCAACAGGCGCTGCGCCAGCCGGAATCCCTGCGCATGGCCGAGCGGACCGTCCCCGCCGGCCAATACTTCATGCTCGGCGACAACCGCGACAACTCCAACGACAGCCGCTACTGGGGCTACGTACCGCGCGCCGACCTGGTCGGCCGGGTGTTCGCCGTCTGGTATGCCGAGGACACCCGGCGCATCGGTTCGGTGCGCTGA
    Protein Properties
    Protein Residues: 179
    Protein Molecular Weight: 20.1 kDa
    Protein Theoretical pI: 10.04
    Hydropathicity (GRAVY score): -0.175
    Charge at pH 7 (predicted): 5.98
    Protein Sequence: 
    >PA1303
MGLLAAIMLAVYLANPFGTASLDPRARLLGVALYKIPSRSMEPTLQQGDFILANAARYAFADPQVGDLVVFRFPPQRSIAYVKRIAGIPGDRVRIDGGRLYVNERPVTEPYLAQQALRQPESLRMAERTVPAGQYFMLGDNRDNSNDSRYWGYVPRADLVGRVFAVWYAEDTRRIGSVR
    References
    External Links:
    Resource Link
    Genome ID: PA1303
    Entrez Gene ID: 881561
    NCBI Protein ID: 15596500
    General Reference: PaperBLAST - Find papers about PA1303 and its homologs