probable transcriptional regulator (PA1261)

Identification
Name: probable transcriptional regulator
Synonyms: Not Available
Gene Name: Not Available
Enzyme Class: Not Available
Biological Properties
General Function: regulation of transcription, DNA-templated, signal transduction, positive regulation of amino acid transport, positive regulation of cellular amino acid metabolic process
Specific Function: sequence-specific DNA binding transcription factor activity, sequence-specific DNA binding, DNA binding, signal transducer activity
Cellular Location: Cytoplasmic
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Function
    sequence-specific DNA binding transcription factor activity
    sequence-specific DNA binding
    DNA binding
    signal transducer activity
    Process
    regulation of transcription, DNA-templated
    signal transduction
    positive regulation of amino acid transport
    positive regulation of cellular amino acid metabolic process
    Gene Properties
    Locus tag: PA1261
    Strand: -
    Entrez Gene ID: 881351
    Accession: NP_249952.1
    GI: 15596458
    Sequence start: 1369418
    Sequence End: 1370092
    Sequence Length: 674
    Gene Sequence: 
    >PA1261
ATGCCCGGCGTGGTGTTCTTCGTCAAGGACGAGCGCGCCCGCTACGTCCTGGTCAACCGCACCCTGGCACGCCGCTGCGGCGTGAAGGACAAGGCCGAACTGCTCGGCCGCAGCGCCGACGAGGTCTTCCCTTCCAGCCTCGGTCCGCTCTATGCCGAGCAGGATCGGCGCGTGCTGCGCGGCGGCGCGACGCTGGAGAACCAGTTGGAGCTGCACCTCTATCCCGGTCGCCAGCCGGGCTGGTGCCTGACCCACAAGCAGGCGCTGCGCGATGCCGACGGGGCGATCATCGGCATGGCCGGCATCTCCCACGACCTGCCGGCGGCGCAGTCGGCGCACCCGGCCTACGGCCGGCTGGCGGCGGTGGATGCGCATATCCGCGAGCACTACGACCAGCCGCTCAGCCTCGCCGATCTCACTGCCATCGCCGGGCTCTCGGTGGCGCAACTGGAGCGTCACTGCAAGCGCATCTTCCAGCTCACCCCACGGCAGATGATCCACAAGGCGCGGCTCGGCGCCGCCTCGCAACTGCTCGCCGGCGACGCGCCGATCACCGAGATCGCCCTGCGCTGCGGCTACACCGACCACAGCGCCTTCAGCCGCCAGTTCAAGGCGCTCACCGGACTCTCGCCGAGCCAGTACCGCGAGACCCATCGCCAGCCCCGAAAAGCGTAA
    Protein Properties
    Protein Residues: 224
    Protein Molecular Weight: 24.7 kDa
    Protein Theoretical pI: 9.83
    Hydropathicity (GRAVY score): -0.321
    Charge at pH 7 (predicted): 10.27
    Protein Sequence: 
    >PA1261
MPGVVFFVKDERARYVLVNRTLARRCGVKDKAELLGRSADEVFPSSLGPLYAEQDRRVLRGGATLENQLELHLYPGRQPGWCLTHKQALRDADGAIIGMAGISHDLPAAQSAHPAYGRLAAVDAHIREHYDQPLSLADLTAIAGLSVAQLERHCKRIFQLTPRQMIHKARLGAASQLLAGDAPITEIALRCGYTDHSAFSRQFKALTGLSPSQYRETHRQPRKA
    References
    External Links:
    Resource Link
    Genome ID: PA1261
    Entrez Gene ID: 881351
    NCBI Protein ID: 15596458
    General Reference: PaperBLAST - Find papers about PA1261 and its homologs