
probable cold-shock protein (PA1159)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | probable cold-shock protein | ||||||||
| Synonyms: | Not Available | ||||||||
| Gene Name: | Not Available | ||||||||
| Enzyme Class: | Not Available | ||||||||
| Biological Properties | |||||||||
| General Function: | regulation of transcription, DNA-templated | ||||||||
| Specific Function: | nucleic acid binding, DNA binding | ||||||||
| Cellular Location: | Cytoplasmic | ||||||||
| KEGG Pathways: |
| ||||||||
| KEGG Reactions: | Not Available | ||||||||
| SMPDB Reactions: | Not Available | ||||||||
| PseudoCyc/BioCyc Reactions: |
| ||||||||
| Complex Reactions: | Not Available | ||||||||
| Transports: | Not Available | ||||||||
| Metabolites: | Not Available | ||||||||
| GO Classification: |
| ||||||||
| Gene Properties | |||||||||
| Locus tag: | PA1159 | ||||||||
| Strand: | + | ||||||||
| Entrez Gene ID: | 877579 | ||||||||
| Accession: | NP_249850.1 | ||||||||
| GI: | 15596356 | ||||||||
| Sequence start: | 1257772 | ||||||||
| Sequence End: | 1257981 | ||||||||
| Sequence Length: | 209 | ||||||||
| Gene Sequence: |
>PA1159 ATGGCTGATCGTGAGGTCGGAACCGTCAAGTGGTTCAATGACGCCAAAGGTTATGGATTCATTCAACGCGATAGCGGTCCGGACGTGTTCGTTCACTACCGCGCCATCCGCGGCGAGGGTCACCGCTCCCTGGTGGAAGGCCAGAAAGTGGAATTCTCGGTGATCCAGGGCCAGAAAGGCCTGCAAGCGGAAGACGTCTCCAAGGTCTGA | ||||||||
| Protein Properties | |||||||||
| Protein Residues: | 69 | ||||||||
| Protein Molecular Weight: | 7.7 kDa | ||||||||
| Protein Theoretical pI: | 7.69 | ||||||||
| Hydropathicity (GRAVY score): | -0.548 | ||||||||
| Charge at pH 7 (predicted): | 0.46 | ||||||||
| Protein Sequence: |
>PA1159 MADREVGTVKWFNDAKGYGFIQRDSGPDVFVHYRAIRGEGHRSLVEGQKVEFSVIQGQKGLQAEDVSKV | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | PaperBLAST - Find papers about PA1159 and its homologs | ||||||||