probable cold-shock protein (PA0961)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | probable cold-shock protein | ||||||||
| Synonyms: | Not Available | ||||||||
| Gene Name: | Not Available | ||||||||
| Enzyme Class: | Not Available | ||||||||
| Biological Properties | |||||||||
| General Function: | regulation of transcription, DNA-templated | ||||||||
| Specific Function: | DNA binding, nucleic acid binding | ||||||||
| Cellular Location: | Cytoplasmic | ||||||||
| KEGG Pathways: |
| ||||||||
| KEGG Reactions: | Not Available | ||||||||
| SMPDB Reactions: | Not Available | ||||||||
| PseudoCyc/BioCyc Reactions: |
| ||||||||
| Complex Reactions: | Not Available | ||||||||
| Transports: | Not Available | ||||||||
| Metabolites: | Not Available | ||||||||
| GO Classification: |
| ||||||||
| Gene Properties | |||||||||
| Locus tag: | PA0961 | ||||||||
| Strand: | - | ||||||||
| Entrez Gene ID: | 882013 | ||||||||
| Accession: | NP_249652 | ||||||||
| GI: | 15596158 | ||||||||
| Sequence start: | 1046720 | ||||||||
| Sequence End: | 1046911 | ||||||||
| Sequence Length: | 191 | ||||||||
| Gene Sequence: |
>PA0961 GTGAAGTGGTTCAACACCTCAAAAGGTTTCGGCTTCATTTCCCGCGATTCGGGCGAGGACATCTTCGTCCACTTCCGAGCGATTCGCGGCGAAGGCCACCGCATCCTCATCGAAGGCCAGCGCGTGGAGTTCTCGGTGGTACAACGGGACAAGGGCCTGCAGGCGGAAGACGTGATCGCCTCCCGCCGCTGA | ||||||||
| Protein Properties | |||||||||
| Protein Residues: | 63 | ||||||||
| Protein Molecular Weight: | 7.2 kDa | ||||||||
| Protein Theoretical pI: | 10.46 | ||||||||
| Hydropathicity (GRAVY score): | -0.413 | ||||||||
| Charge at pH 7 (predicted): | 2.47 | ||||||||
| Protein Sequence: |
>PA0961 MKWFNTSKGFGFISRDSGEDIFVHFRAIRGEGHRILIEGQRVEFSVVQRDKGLQAEDVIASRR | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | PaperBLAST - Find papers about PA0961 and its homologs | ||||||||