hypothetical protein (PA0909)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | hypothetical protein | ||||||||
| Synonyms: | Not Available | ||||||||
| Gene Name: | Not Available | ||||||||
| Enzyme Class: | Not Available | ||||||||
| Biological Properties | |||||||||
| General Function: | cellular response to DNA damage stimulus, autolysis | ||||||||
| Specific Function: | Not Available | ||||||||
| Cellular Location: | Cytoplasmic Membrane | ||||||||
| KEGG Pathways: |
| ||||||||
| KEGG Reactions: | Not Available | ||||||||
| SMPDB Reactions: | Not Available | ||||||||
| PseudoCyc/BioCyc Reactions: |
| ||||||||
| Complex Reactions: | Not Available | ||||||||
| Transports: | Not Available | ||||||||
| Metabolites: | Not Available | ||||||||
| GO Classification: |
| ||||||||
| Gene Properties | |||||||||
| Locus tag: | PA0909 | ||||||||
| Strand: | + | ||||||||
| Entrez Gene ID: | 882062 | ||||||||
| Accession: | NP_249600.1 | ||||||||
| GI: | 15596106 | ||||||||
| Sequence start: | 993776 | ||||||||
| Sequence End: | 994051 | ||||||||
| Sequence Length: | 275 | ||||||||
| Gene Sequence: |
>PA0909 ATGGTTGATCCGCTGTCCACCCTGACCGTGCTGGTCTGCTCGGCGATCTGCATGCGCCTGATCACCTATCGCCGCGCCGGCGCGCGTTTCCGCCCCGGCGTTTCCCTGTGCGCCTACCTGCTGGCGTTGTGCACCGGCTGCCAGGCGCTGGGAATAGTGGCCGGGTTGTATCGCGCCGAGCACCTCTCGCCGTGGATGCTCGGGGTACTGCTGGTGCTGCTGGTCCTGCTGTTGCAGGCGCGCGGCAACCTGGCGCGGGTCCTGCGCCTGCATTGA | ||||||||
| Protein Properties | |||||||||
| Protein Residues: | 91 | ||||||||
| Protein Molecular Weight: | 9.9 kDa | ||||||||
| Protein Theoretical pI: | 9.92 | ||||||||
| Hydropathicity (GRAVY score): | 1.001 | ||||||||
| Charge at pH 7 (predicted): | 7.3 | ||||||||
| Protein Sequence: |
>PA0909 MVDPLSTLTVLVCSAICMRLITYRRAGARFRPGVSLCAYLLALCTGCQALGIVAGLYRAEHLSPWMLGVLLVLLVLLLQARGNLARVLRLH | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | PaperBLAST - Find papers about PA0909 and its homologs | ||||||||