coat protein B of bacteriophage Pf1 (PA0723)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | coat protein B of bacteriophage Pf1 | ||||||||
| Synonyms: | Not Available | ||||||||
| Gene Name: | coaB | ||||||||
| Enzyme Class: | Not Available | ||||||||
| Biological Properties | |||||||||
| General Function: | Not Available | ||||||||
| Specific Function: | Not Available | ||||||||
| Cellular Location: | Cytoplasmic Membrane | ||||||||
| KEGG Pathways: |
| ||||||||
| KEGG Reactions: | Not Available | ||||||||
| SMPDB Reactions: | Not Available | ||||||||
| PseudoCyc/BioCyc Reactions: |
| ||||||||
| Complex Reactions: | Not Available | ||||||||
| Transports: | Not Available | ||||||||
| Metabolites: | Not Available | ||||||||
| GO Classification: | Not Available | ||||||||
| Gene Properties | |||||||||
| Locus tag: | PA0723 | ||||||||
| Strand: | + | ||||||||
| Entrez Gene ID: | 880778 | ||||||||
| Accession: | NP_249414.1 | ||||||||
| GI: | 15595920 | ||||||||
| Sequence start: | 790986 | ||||||||
| Sequence End: | 791234 | ||||||||
| Sequence Length: | 248 | ||||||||
| Gene Sequence: |
>PA0723 ATGAAAGCAATGAAGCAACGCATCGCCAAGTTCAGCCCGGTCGCCTCGTTCCGCAACCTGTGCATCGCCGGTTCCGTCACTGCCGCGACTTCGCTGCCGGCCTTCGCCGGGGTGATCGACACCAGCGCGGTGGAATCGGCGATCACCGATGGCCAGGGCGATATGAAGGCCATTGGCGGCTACATCGTCGGCGCCCTGGTGATCCTGGCCGTTGCCGGCCTGATCTACAGCATGTTGCGCAAGGCGTAA | ||||||||
| Protein Properties | |||||||||
| Protein Residues: | 82 | ||||||||
| Protein Molecular Weight: | 8.4 kDa | ||||||||
| Protein Theoretical pI: | 10.17 | ||||||||
| Hydropathicity (GRAVY score): | 0.717 | ||||||||
| Charge at pH 7 (predicted): | 3.95 | ||||||||
| Protein Sequence: |
>PA0723 MKAMKQRIAKFSPVASFRNLCIAGSVTAATSLPAFAGVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | PaperBLAST - Find papers about PA0723 and its homologs | ||||||||