hypothetical protein of bacteriophage Pf1 (PA0721)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | hypothetical protein of bacteriophage Pf1 | ||||||||
| Synonyms: | Not Available | ||||||||
| Gene Name: | Not Available | ||||||||
| Enzyme Class: | Not Available | ||||||||
| Biological Properties | |||||||||
| General Function: | Not Available | ||||||||
| Specific Function: | Not Available | ||||||||
| Cellular Location: | Cytoplasmic Membrane | ||||||||
| KEGG Pathways: |
| ||||||||
| KEGG Reactions: | Not Available | ||||||||
| SMPDB Reactions: | Not Available | ||||||||
| PseudoCyc/BioCyc Reactions: |
| ||||||||
| Complex Reactions: | Not Available | ||||||||
| Transports: | Not Available | ||||||||
| Metabolites: | Not Available | ||||||||
| GO Classification: | Not Available | ||||||||
| Gene Properties | |||||||||
| Locus tag: | PA0721 | ||||||||
| Strand: | + | ||||||||
| Entrez Gene ID: | 880780 | ||||||||
| Accession: | NP_249412.1 | ||||||||
| GI: | 15595918 | ||||||||
| Sequence start: | 790617 | ||||||||
| Sequence End: | 790709 | ||||||||
| Sequence Length: | 92 | ||||||||
| Gene Sequence: |
>PA0721 ATGCTCCGCTATCTCTCGCTGTTCGCGGTAGGTCTGGCCACCGGCTACGCCTGGGGCTGGATCGACGGCCTAGCGGCCTCCCTGGCTGTTTGA | ||||||||
| Protein Properties | |||||||||
| Protein Residues: | 30 | ||||||||
| Protein Molecular Weight: | 3.2 kDa | ||||||||
| Protein Theoretical pI: | 6.23 | ||||||||
| Hydropathicity (GRAVY score): | 1.163 | ||||||||
| Charge at pH 7 (predicted): | -0.02 | ||||||||
| Protein Sequence: |
>PA0721 MLRYLSLFAVGLATGYAWGWIDGLAASLAV | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | PaperBLAST - Find papers about PA0721 and its homologs | ||||||||