hypothetical protein of bacteriophage Pf1 (PA0721)
Identification | |||||||||
---|---|---|---|---|---|---|---|---|---|
Name: | hypothetical protein of bacteriophage Pf1 | ||||||||
Synonyms: | Not Available | ||||||||
Gene Name: | Not Available | ||||||||
Enzyme Class: | Not Available | ||||||||
Biological Properties | |||||||||
General Function: | Not Available | ||||||||
Specific Function: | Not Available | ||||||||
Cellular Location: | Cytoplasmic Membrane | ||||||||
KEGG Pathways: |
| ||||||||
KEGG Reactions: | Not Available | ||||||||
SMPDB Reactions: | Not Available | ||||||||
PseudoCyc/BioCyc Reactions: |
| ||||||||
Complex Reactions: | Not Available | ||||||||
Transports: | Not Available | ||||||||
Metabolites: | Not Available | ||||||||
GO Classification: | Not Available | ||||||||
Gene Properties | |||||||||
Locus tag: | PA0721 | ||||||||
Strand: | + | ||||||||
Entrez Gene ID: | 880780 | ||||||||
Accession: | NP_249412.1 | ||||||||
GI: | 15595918 | ||||||||
Sequence start: | 790617 | ||||||||
Sequence End: | 790709 | ||||||||
Sequence Length: | 92 | ||||||||
Gene Sequence: |
>PA0721 ATGCTCCGCTATCTCTCGCTGTTCGCGGTAGGTCTGGCCACCGGCTACGCCTGGGGCTGGATCGACGGCCTAGCGGCCTCCCTGGCTGTTTGA | ||||||||
Protein Properties | |||||||||
Protein Residues: | 30 | ||||||||
Protein Molecular Weight: | 3.2 kDa | ||||||||
Protein Theoretical pI: | 6.23 | ||||||||
Hydropathicity (GRAVY score): | 1.163 | ||||||||
Charge at pH 7 (predicted): | -0.02 | ||||||||
Protein Sequence: |
>PA0721 MLRYLSLFAVGLATGYAWGWIDGLAASLAV | ||||||||
References | |||||||||
External Links: |
| ||||||||
General Reference: | PaperBLAST - Find papers about PA0721 and its homologs |