30S ribosomal protein S21 (PA0579)
Identification | |||||||||
---|---|---|---|---|---|---|---|---|---|
Name: | 30S ribosomal protein S21 | ||||||||
Synonyms: | Not Available | ||||||||
Gene Name: | rpsU | ||||||||
Enzyme Class: | Not Available | ||||||||
Biological Properties | |||||||||
General Function: | translation | ||||||||
Specific Function: | structural constituent of ribosome | ||||||||
Cellular Location: | Cytoplasmic | ||||||||
KEGG Pathways: |
| ||||||||
KEGG Reactions: | Not Available | ||||||||
SMPDB Reactions: | Not Available | ||||||||
PseudoCyc/BioCyc Reactions: |
| ||||||||
Complex Reactions: | Not Available | ||||||||
Transports: | Not Available | ||||||||
Metabolites: | Not Available | ||||||||
GO Classification: |
| ||||||||
Gene Properties | |||||||||
Locus tag: | PA0579 | ||||||||
Strand: | - | ||||||||
Entrez Gene ID: | 880307 | ||||||||
Accession: | NP_249270.1 | ||||||||
GI: | 15595776 | ||||||||
Sequence start: | 638900 | ||||||||
Sequence End: | 639115 | ||||||||
Sequence Length: | 215 | ||||||||
Gene Sequence: |
>PA0579 ATGCCAGCCGTCAAAGTAAAAGAGAACGAACCCTTCGACGTAGCCCTGCGTCGTTTCAAGCGCTCCTGCGAAAAAGCAGGTGTACTGGCTGAAGTTCGCAGCCGCGAGTTCTACGAGAAGCCCACTGCCGAGCGCAAGCGCAAGGCCGCTGCCGCAGTGAAGCGCCACGCGAAGAAAGTACAGCGCGAACAGCGCCGTCGCGAGCGCCTGTACTGA | ||||||||
Protein Properties | |||||||||
Protein Residues: | 71 | ||||||||
Protein Molecular Weight: | 8.5 kDa | ||||||||
Protein Theoretical pI: | 11.43 | ||||||||
Hydropathicity (GRAVY score): | -1.193 | ||||||||
Charge at pH 7 (predicted): | 13.19 | ||||||||
Protein Sequence: |
>PA0579 MPAVKVKENEPFDVALRRFKRSCEKAGVLAEVRSREFYEKPTAERKRKAAAAVKRHAKKVQREQRRRERLY | ||||||||
References | |||||||||
External Links: |
| ||||||||
General Reference: | PaperBLAST - Find papers about PA0579 and its homologs |