Identification
Name: conserved hypothetical protein
Synonyms: yqaE
Gene Name: Not Available
Enzyme Class: Not Available
Biological Properties
General Function: Not Available
Specific Function: Not Available
Cellular Location: Cytoplasmic Membrane
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Component
    integral component of membrane
    Gene Properties
    Locus tag: PA0567
    Strand: +
    Entrez Gene ID: 877760
    Accession: NP_249258.1
    GI: 15595764
    Sequence start: 622726
    Sequence End: 622884
    Sequence Length: 158
    Gene Sequence:
    >PA0567
    ATGGACCTGATCCGCATCCTCATCGCCATCCTCCTGCCGCCGCTGGGCGTGTTCCTGCAAGTCGGCTTCGGCGGCGCCTTCTGGCTGAACATCCTGCTCACCCTGCTCGGCTACATCCCGGGCATCGTCCACGCGGTGTACATCATCGCCAAGCGTTGA
    Protein Properties
    Protein Residues: 52
    Protein Molecular Weight: 5.7 kDa
    Protein Theoretical pI: 10.01
    Hydropathicity (GRAVY score): 1.512
    Charge at pH 7 (predicted): 2.22
    Protein Sequence:
    >PA0567
    MDLIRILIAILLPPLGVFLQVGFGGAFWLNILLTLLGYIPGIVHAVYIIAKR
    References
    External Links:
    Resource Link
    Genome ID: PA0567
    Entrez Gene ID: 877760
    NCBI Protein ID: 15595764
    General Reference: PaperBLAST - Find papers about PA0567 and its homologs