Identification
Name: hypothetical protein
Synonyms: nirP
Gene Name: Not Available
Enzyme Class: Not Available
Biological Properties
General Function: Not Available
Specific Function: Not Available
Cellular Location: Cytoplasmic Membrane
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Component
    integral component of membrane
    Gene Properties
    Locus tag: PA0522
    Strand: +
    Entrez Gene ID: 882203
    Accession: NP_249213.1
    GI: 15595719
    Sequence start: 581668
    Sequence End: 581925
    Sequence Length: 257
    Gene Sequence:
    >PA0522
    ATGCGAACCCTGACCCTCTGCTGGCTGGCGTTGCTGGCGCTGGCCGTGACCGGTGTGCTGCTGGGTGGCGCCGGCGACTCTCCCTGGCTGCTGGCGGCGGTGCTGGCCTGCGCGGTGGCCAAGGGTTGGCTGATCGGCGAGCGCTTCATGGAGCTGGCCCATGCCCCGGCGCTATGGCGCCGCCTGCTGCTGGCCTGGCCGCTGCTGATGGCCCTGGCGGTGGGCGCTGCGCTGTACCTGGCGCGGATGAATAACTGA
    Protein Properties
    Protein Residues: 85
    Protein Molecular Weight: 9.1 kDa
    Protein Theoretical pI: 9.54
    Hydropathicity (GRAVY score): 1.1
    Charge at pH 7 (predicted): 3.16
    Protein Sequence:
    >PA0522
    MRTLTLCWLALLALAVTGVLLGGAGDSPWLLAAVLACAVAKGWLIGERFMELAHAPALWRRLLLAWPLLMALAVGAALYLARMNN
    References
    External Links:
    Resource Link
    Genome ID: PA0522
    Entrez Gene ID: 882203
    NCBI Protein ID: 15595719
    General Reference: PaperBLAST - Find papers about PA0522 and its homologs