Identification
Name: FiuI
Synonyms: fiuI
Gene Name: fiuI
Enzyme Class: Not Available
Biological Properties
General Function: DNA-templated transcription, initiation, regulation of transcription, DNA-templated, regulation of iron ion transport
Specific Function: sigma factor activity, DNA binding, sequence-specific DNA binding transcription factor activity
Cellular Location: Cytoplasmic
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Function
    sigma factor activity
    DNA binding
    sequence-specific DNA binding transcription factor activity
    Process
    DNA-templated transcription, initiation
    regulation of transcription, DNA-templated
    regulation of iron ion transport
    Gene Properties
    Locus tag: PA0472
    Strand: -
    Entrez Gene ID: 880895
    Accession: NP_249163.1
    GI: 15595669
    Sequence start: 533509
    Sequence End: 534027
    Sequence Length: 518
    Gene Sequence:
    >PA0472
    GTGTCAGCGGGTGACGTCAGCAACAGCGAATTCGTGGGTAGCCTGTACCGGGACCACCGCGGCTGGCTGCTTGCCTGGCTGAACCGCAACCTCGGCTGCCGCCAGCGCGCCGAAGACCTCAGCCAGGACACCTTCGTTCGCCTCCTCGGCCGCCCGGAGCTGCCCGGCCTGCGCGAACCGCGCGCGTTCCTGGCGAAGGTGGCGCGCGGTCTGATGATCGACCACTTCCGCCGCGCCGCCCTTGAACAGGCCTATCTCGCCGAACTGGCGCTGGTTCCGGAAGCGGAGCAGCCTTCGGCCGAAGAGCAGTACCTGATTCTCGAGGACCTCCGCGAGATCGATCGCCTGCTTGGCACGCTGTCGCTGAAGGCGCGTAGCGCGTTTCTCTATAGCCGCCTGGACGGCATGCCCCACGCGGAGATCGCCGAGCGTCTCGGAGTCTCGGTGCCGCGCGTGCGCCAATACCTGGCCCAGGGTCTGCGCCAGTGCTACATCGCCCTCTACGGAGAGCCCCGGTGA
    Protein Properties
    Protein Residues: 172
    Protein Molecular Weight: 19.5 kDa
    Protein Theoretical pI: 7.5
    Hydropathicity (GRAVY score): -0.24
    Charge at pH 7 (predicted): 0.65
    Protein Sequence:
    >PA0472
    MSAGDVSNSEFVGSLYRDHRGWLLAWLNRNLGCRQRAEDLSQDTFVRLLGRPELPGLREPRAFLAKVARGLMIDHFRRAALEQAYLAELALVPEAEQPSAEEQYLILEDLREIDRLLGTLSLKARSAFLYSRLDGMPHAEIAERLGVSVPRVRQYLAQGLRQCYIALYGEPR
    References
    External Links:
    Resource Link
    Genome ID: PA0472
    Entrez Gene ID: 880895
    NCBI Protein ID: 15595669
    General Reference: PaperBLAST - Find papers about PA0472 and its homologs