Identification
Name: multidrug resistance operon repressor MexR
Synonyms: Not Available
Gene Name: mexR
Enzyme Class: Not Available
Biological Properties
General Function: negative regulation of transcription, DNA-templated, negative regulation of transmembrane transport, negative regulation of protein secretion, regulation of transcription, DNA-templated, negative regulation of transcription, DNA-templated, negative regulation of transmembrane transport
Specific Function: transcription regulatory region DNA binding, sequence-specific DNA binding transcription factor activity
Cellular Location: Cytoplasmic
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Component
    intracellular
    Function
    transcription regulatory region DNA binding
    sequence-specific DNA binding transcription factor activity
    Process
    negative regulation of transcription, DNA-templated
    negative regulation of transmembrane transport
    negative regulation of protein secretion
    regulation of transcription, DNA-templated
    negative regulation of transcription, DNA-templated
    negative regulation of transmembrane transport
    Gene Properties
    Locus tag: PA0424
    Strand: -
    Entrez Gene ID: 877857
    Accession: NP_249115.1
    GI: 15595621
    Sequence start: 471306
    Sequence End: 471749
    Sequence Length: 443
    Gene Sequence:
    >PA0424
    ATGAACTACCCCGTGAATCCCGACCTGATGCCCGCGCTGATGGCGGTCTTCCAGCATGTGCGGACGCGCATCCAGAGCGAGCTCGATTGCCAGCGACTCGACCTGACCCCGCCCGACGTCCATGTATTGAAGCTTATCGACGAACAACGCGGGCTGAACCTGCAGGACCTGGGACGCCAGATGTGCCGCGACAAGGCACTGATCACCCGGAAGATCCGCGAGCTGGAGGGAAGAAACCTGGTCCGCCGCGAGCGCAACCCCAGCGACCAGCGCAGCTTCCAGCTCTTCCTCACCGACGAGGGGCTGGCCATCCACCAGCATGCGGAGGCCATCATGTCACGCGTGCATGACGAGTTGTTTGCCCCGCTCACCCCGGTGGAACAGGCCACCCTGGTGCATCTCCTCGACCAGTGCCTGGCCGCGCAACCGCTTGAGGATATTTAA
    Protein Properties
    Protein Residues: 147
    Protein Molecular Weight: 17 kDa
    Protein Theoretical pI: 5.92
    Hydropathicity (GRAVY score): -0.355
    Charge at pH 7 (predicted): -3.65
    Protein Sequence:
    >PA0424
    MNYPVNPDLMPALMAVFQHVRTRIQSELDCQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELFAPLTPVEQATLVHLLDQCLAAQPLEDI
    References
    External Links:
    Resource Link
    Genome ID: PA0424
    Entrez Gene ID: 877857
    NCBI Protein ID: 15595621
    General Reference: PaperBLAST - Find papers about PA0424 and its homologs