Identification
Name: transcriptional regulator PyrR uracil phosphoribosyltransferase PyrR
Synonyms: Not Available
Gene Name: pyrR
Enzyme Class: Not Available
Biological Properties
General Function: regulation of transcription, DNA-templated, nucleotide metabolic process, nucleoside metabolic process
Specific Function: methyltransferase activity
Cellular Location: Cytoplasmic
KEGG Pathways:
  • pyrimidine nucleobases salvage I PWY-7183
  • superpathway of pyrimidine nucleobases salvage PWY-7208
  • pyrimidine nucleobases salvage II PWY-7194
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Function
    methyltransferase activity
    Process
    regulation of transcription, DNA-templated
    nucleotide metabolic process
    nucleoside metabolic process
    Gene Properties
    Locus tag: PA0403
    Strand: -
    Entrez Gene ID: 878259
    Accession: NP_249094.1
    GI: 15595600
    Sequence start: 445715
    Sequence End: 446227
    Sequence Length: 512
    Gene Sequence:
    >PA0403
    ATGAGCCTACCCAATCCCGCCGAACTCCTGCCGCGCATGGCCAGCGACCTGCGCGCCCATCTCGCCGAGCGCGGCATCGAGCGGCCGCGCTTCGTCGGCATCCATACCGGCGGCATCTGGGTCGCCGAGGCGCTGCTGAGGGAACTGGGCAACCAAGAGCCGCTGGGCACCCTCGACGTCTCCTTCTACCGCGACGACTTCACCCAGAACGGCCTGCATCCGCAGGTCCGCCCGTCGGCGCTGCCGTTCGAGATCGACGGCCAGCACCTGGTGCTGGTGGACGACGTGCTGATGAGCGGCCGTACCATCCGCGCCGCACTCAACGAACTGTTCGACTACGGCCGTCCGGCCAGCGTGACCCTGGTCTGCCTGCTCGACCTGAACGCCCGGGAGTTGCCTATCCGCCCCGACGTGGTCGGCCAGACCCTGTCCCTGGGTCGCGATGAACGGGTAAAATTGGTCGGTCCCGCACCGCTCGCCCTCGAGCGCAAGGTCCTTTCCTCCGCTTCCTGA
    Protein Properties
    Protein Residues: 170
    Protein Molecular Weight: 18.7 kDa
    Protein Theoretical pI: 5.65
    Hydropathicity (GRAVY score): -0.039
    Charge at pH 7 (predicted): -3.07
    Protein Sequence:
    >PA0403
    MSLPNPAELLPRMASDLRAHLAERGIERPRFVGIHTGGIWVAEALLRELGNQEPLGTLDVSFYRDDFTQNGLHPQVRPSALPFEIDGQHLVLVDDVLMSGRTIRAALNELFDYGRPASVTLVCLLDLNARELPIRPDVVGQTLSLGRDERVKLVGPAPLALERKVLSSAS
    References
    External Links:
    Resource Link
    Genome ID: PA0403
    Entrez Gene ID: 878259
    NCBI Protein ID: 15595600
    General Reference: PaperBLAST - Find papers about PA0403 and its homologs