RNA pyrophosphohydrolase (PA0336)
| Identification | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Name: | RNA pyrophosphohydrolase | |||||||||
| Synonyms: |
| |||||||||
| Gene Name: | rppH | |||||||||
| Enzyme Class: | Not Available | |||||||||
| Biological Properties | ||||||||||
| General Function: | Involved in hydrolase activity | |||||||||
| Specific Function: | Master regulator of 5'-dependent mRNA decay. Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage. Preferentially hydrolyzes diadenosine penta-phosphate with ATP as one of the reaction products. Also able to hydrolyze diadenosine hexa- and tetra-phosphate. Has no activity on diadenosine tri-phosphate, ADP-ribose, NADH and UDP- glucose. In the meningitis causing strain E.coli K1, has been shown to play a role in HBMEC (human brain microvascular endothelial cells) invasion in vitro | |||||||||
| Cellular Location: | Cytoplasmic | |||||||||
| KEGG Pathways: |
| |||||||||
| KEGG Reactions: | Not Available | |||||||||
| SMPDB Reactions: | Not Available | |||||||||
| PseudoCyc/BioCyc Reactions: |
| |||||||||
| Complex Reactions: | Not Available | |||||||||
| Transports: | Not Available | |||||||||
| Metabolites: |
| |||||||||
| GO Classification: |
| |||||||||
| Gene Properties | ||||||||||
| Locus tag: | PA0336 | |||||||||
| Strand: | + | |||||||||
| Entrez Gene ID: | 882290 | |||||||||
| Accession: | NP_249027.1 | |||||||||
| GI: | 15595533 | |||||||||
| Sequence start: | 378096 | |||||||||
| Sequence End: | 378575 | |||||||||
| Sequence Length: | 479 | |||||||||
| Gene Sequence: |
>PA0336 GTGATCGATTCCGATGGTTTTCGCCCGAATGTCGGCATCATTCTCGCCAACGAGGCGGGGCAGGTGCTGTGGGCGCGGCGTATCAATCAGGAAGCCTGGCAGTTCCCGCAGGGAGGCATCAATGATCGCGAAACGCCGGAAGAGGCGCTGTATCGCGAGTTGAACGAAGAAGTCGGGCTGGAGGCCGGGGACGTGCGCATCCTGGCCTGCACCCGCGGCTGGCTGCGCTACCGTTTGCCGCAGCGCCTGGTGCGGACCCACAGCCAGCCGCTGTGCATCGGCCAGAAGCAGAAATGGTTCCTGCTGCGGCTGATGTCCGACGAGGCGCGCGTGCGCATGGATATCACCAGCAAGCCCGAGTTCGACGGCTGGCGCTGGGTGAGTTACTGGTACCCCCTGGGACAGGTGGTGACCTTCAAGCGCGAGGTCTACCGCCGCGCCCTGAAGGAACTGGCCCCGCGCCTTCTGGCGCGGGACTGA | |||||||||
| Protein Properties | ||||||||||
| Protein Residues: | 159 | |||||||||
| Protein Molecular Weight: | 18.7 kDa | |||||||||
| Protein Theoretical pI: | 9.51 | |||||||||
| Hydropathicity (GRAVY score): | -0.5 | |||||||||
| Charge at pH 7 (predicted): | 4.17 | |||||||||
| Protein Sequence: |
>PA0336 MIDSDGFRPNVGIILANEAGQVLWARRINQEAWQFPQGGINDRETPEEALYRELNEEVGLEAGDVRILACTRGWLRYRLPQRLVRTHSQPLCIGQKQKWFLLRLMSDEARVRMDITSKPEFDGWRWVSYWYPLGQVVTFKREVYRRALKELAPRLLARD | |||||||||
| References | ||||||||||
| External Links: |
| |||||||||
| General Reference: | PaperBLAST - Find papers about PA0336 and its homologs | |||||||||