hypothetical protein (PA0310)

Identification
Name: hypothetical protein
Synonyms: Not Available
Gene Name: Not Available
Enzyme Class: Not Available
Biological Properties
General Function: oxidation-reduction process
Specific Function: oxidoreductase activity, oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors, iron ion binding, oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, L-ascorbic acid binding
Cellular Location: Cytoplasmic
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Function
    oxidoreductase activity
    oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors
    iron ion binding
    oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
    L-ascorbic acid binding
    Process
    oxidation-reduction process
    Gene Properties
    Locus tag: PA0310
    Strand: +
    Entrez Gene ID: 880668
    Accession: NP_249001.1
    GI: 15595507
    Sequence start: 350890
    Sequence End: 351588
    Sequence Length: 698
    Gene Sequence: 
    >PA0310
ATGGGGCGCTATTGTCGACATGCGGCGGACCGCTTGTCGAGACACCGGGGCGGCACGCTACAATGGACAATGCACATCAACGTCAATCATCCCCTCCTGCATCGCATCGTCGATGAACTGGTCGACCAGGGCTGGTCGCACCAGAGCATCTTCATGCCTGAGCGTCTGACCACCAGATTGGCCGAAGAGTGCCGCACCCGTGCGGTCGCGGGCGACCTGACCCCGGCGGCGATCGGCCGCGGCGACGGCCAGGTGATCCGCGAAGGCATCCGCGGCGACCTCACGCAATGGCTGGAGCCCGGAGAATCCGAGGCCTGCGACGAATACCTGGGGGTGATGGACAGCTTGCGCCAGGCGCTCAACGCCTCGCTGTTCCTCGGCCTCGAGGATTTCGAGTGCCACTTCGCGCTGTACCCGCCGGGCGCCTATTACCAGAAGCATGTCGATCGTTTCCGCGACGACGACGCACGCACCGTCTCCGCGGTTCTCTACCTCAACGATGCCTGGTTGCCCGAGCATGGCGGCGCGCTGCGCCTGCACCTGCCGCAGCGGCAGGTGGACATCCAGCCGACGGGCGGTAGCCTGGTGGTGTTTATGTCCGCCGGCACCGAGCACGAAGTCCTGCCCGCCAGCCGCGACCGGCTGTCGCTGACCGGCTGGTTCCGCCGGCGCAACGAATCCCTCCTGCAACTCTCCTGA
    Protein Properties
    Protein Residues: 232
    Protein Molecular Weight: 26.3 kDa
    Protein Theoretical pI: 6.43
    Hydropathicity (GRAVY score): -0.407
    Charge at pH 7 (predicted): -3.48
    Protein Sequence: 
    >PA0310
MGRYCRHAADRLSRHRGGTLQWTMHINVNHPLLHRIVDELVDQGWSHQSIFMPERLTTRLAEECRTRAVAGDLTPAAIGRGDGQVIREGIRGDLTQWLEPGESEACDEYLGVMDSLRQALNASLFLGLEDFECHFALYPPGAYYQKHVDRFRDDDARTVSAVLYLNDAWLPEHGGALRLHLPQRQVDIQPTGGSLVVFMSAGTEHEVLPASRDRLSLTGWFRRRNESLLQLS
    References
    External Links:
    Resource Link
    Genome ID: PA0310
    Entrez Gene ID: 880668
    NCBI Protein ID: 15595507
    General Reference: PaperBLAST - Find papers about PA0310 and its homologs