Identification |
Name: |
protocatechuate 3,4-dioxygenase, beta subunit |
Synonyms: |
Not Available |
Gene Name: |
pcaH |
Enzyme Class: |
Not Available |
Biological Properties |
General Function: |
carbon utilization, cellular catabolic process, oxidation-reduction process, protocatechuate catabolic process, cellular aromatic compound metabolic process |
Specific Function: |
iron ion binding, protocatechuate 3,4-dioxygenase activity, catalytic activity, ferric iron binding, oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen |
Cellular Location: |
Cytoplasmic |
KEGG Pathways: |
|
KEGG Reactions: |
Not Available |
SMPDB Reactions: |
Not Available |
PseudoCyc/BioCyc Reactions: |
| protocatechuate + oxygen → 3-carboxy- cis, cis-muconate + 2 H +ReactionCard | | gallate + oxygen = 2-pyrone-4,6-dicarboxylate + H 2O ReactionCard |
|
Complex Reactions: |
Not Available |
Transports: |
Not Available |
Metabolites: |
Not Available |
GO Classification: |
Function |
---|
iron ion binding | protocatechuate 3,4-dioxygenase activity | catalytic activity | ferric iron binding | oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen | Process |
---|
carbon utilization | cellular catabolic process | oxidation-reduction process | protocatechuate catabolic process | cellular aromatic compound metabolic process |
|
Gene Properties |
Locus tag: |
PA0153 |
Strand: |
+ |
Entrez Gene ID: |
878130 |
Accession: |
NP_248843.1 |
GI: |
15595351 |
Sequence start: |
174773 |
Sequence End: |
175492 |
Sequence Length: |
719 |
Gene Sequence: |
>PA0153
ATGCACGACGCCGAAAGCCGTCGTTTCGTCATCCGTGACCGAAACTGGCACCCCAAAGCCTTGACCCCCGACTACAAGACCTCCGTGCCGCGCTCGCCGAGCCAGGCGCTGGTGAGCATCCCGCAATCGCTCTCGGAAACCAGCGGGCCGGACTTCTCCCACCTCAGGCTCGGCCGCCACGACAACGACCTGCTGCTCAACTTCGACCACGGCGGCCTGCCCCAGGGCGAGCGCATCATCATGTTCGGCCGGGTCTTCGACCAGTACGGCAAGCCGGTCCCGCACACCCTGGTGGAGATGTGGCAGGCCAACGCCGGCGGGCGCTACCGGCACAAGAACGACCGCTACCTGGCGCCGCTCGACCCGAACTTCGGCGGCGTCGGCCGGACCCTCACCGACAGCGAGGGCCACTATTACTTCCGCACCATCAAGCCCGGGCCCTATCCCTGGCGCAACGGCCCCAACGACTGGCGCCCGGCGCACATCCACGTGTCTGTCAGCGGCCCGGCGATCGCCGCGCGGCTGGTCACCCAGATGTACTTCGAGGGCGACCCGCTGATCCCCAAGTGCCCGATCATCCGCACCCTTGCCGACCCGGAGGCGGCGCAGAGCCTGATCGGCCGGCTCGACATGAGCATGGCCAACCCGATGGATTGCCTGGCCTACCGCTTCGACATCGTCCTGCGCGGGCAGCGTAAGACCTTCTTCGAGAACGCCTGA |
Protein Properties |
Protein Residues: |
239 |
Protein Molecular Weight: |
27.1 kDa |
Protein Theoretical pI: |
9.3 |
Hydropathicity (GRAVY score): |
-0.548 |
Charge at pH 7 (predicted): |
6.33 |
Protein Sequence: |
>PA0153
MHDAESRRFVIRDRNWHPKALTPDYKTSVPRSPSQALVSIPQSLSETSGPDFSHLRLGRHDNDLLLNFDHGGLPQGERIIMFGRVFDQYGKPVPHTLVEMWQANAGGRYRHKNDRYLAPLDPNFGGVGRTLTDSEGHYYFRTIKPGPYPWRNGPNDWRPAHIHVSVSGPAIAARLVTQMYFEGDPLIPKCPIIRTLADPEAAQSLIGRLDMSMANPMDCLAYRFDIVLRGQRKTFFENA |
References |
External Links: |
|
General Reference: |
PaperBLAST - Find papers about PA0153 and its homologs
|