Identification
Name: protocatechuate 3,4-dioxygenase, beta subunit
Synonyms: Not Available
Gene Name: pcaH
Enzyme Class: Not Available
Biological Properties
General Function: carbon utilization, cellular catabolic process, oxidation-reduction process, protocatechuate catabolic process, cellular aromatic compound metabolic process
Specific Function: iron ion binding, protocatechuate 3,4-dioxygenase activity, catalytic activity, ferric iron binding, oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
Cellular Location: Cytoplasmic
KEGG Pathways:
KEGG Reactions: Not Available
SMPDB Reactions: Not Available
PseudoCyc/BioCyc Reactions:
Thumb
protocatechuate + oxygen → 3-carboxy-cis,cis-muconate + 2 H+
ReactionCard
Thumb
gallate + oxygen = 2-pyrone-4,6-dicarboxylate + H2O
ReactionCard
Complex Reactions: Not Available
Transports: Not Available
Metabolites: Not Available
GO Classification:
Function
iron ion binding
protocatechuate 3,4-dioxygenase activity
catalytic activity
ferric iron binding
oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
Process
carbon utilization
cellular catabolic process
oxidation-reduction process
protocatechuate catabolic process
cellular aromatic compound metabolic process
Gene Properties
Locus tag: PA0153
Strand: +
Entrez Gene ID: 878130
Accession: NP_248843.1
GI: 15595351
Sequence start: 174773
Sequence End: 175492
Sequence Length: 719
Gene Sequence:
>PA0153
ATGCACGACGCCGAAAGCCGTCGTTTCGTCATCCGTGACCGAAACTGGCACCCCAAAGCCTTGACCCCCGACTACAAGACCTCCGTGCCGCGCTCGCCGAGCCAGGCGCTGGTGAGCATCCCGCAATCGCTCTCGGAAACCAGCGGGCCGGACTTCTCCCACCTCAGGCTCGGCCGCCACGACAACGACCTGCTGCTCAACTTCGACCACGGCGGCCTGCCCCAGGGCGAGCGCATCATCATGTTCGGCCGGGTCTTCGACCAGTACGGCAAGCCGGTCCCGCACACCCTGGTGGAGATGTGGCAGGCCAACGCCGGCGGGCGCTACCGGCACAAGAACGACCGCTACCTGGCGCCGCTCGACCCGAACTTCGGCGGCGTCGGCCGGACCCTCACCGACAGCGAGGGCCACTATTACTTCCGCACCATCAAGCCCGGGCCCTATCCCTGGCGCAACGGCCCCAACGACTGGCGCCCGGCGCACATCCACGTGTCTGTCAGCGGCCCGGCGATCGCCGCGCGGCTGGTCACCCAGATGTACTTCGAGGGCGACCCGCTGATCCCCAAGTGCCCGATCATCCGCACCCTTGCCGACCCGGAGGCGGCGCAGAGCCTGATCGGCCGGCTCGACATGAGCATGGCCAACCCGATGGATTGCCTGGCCTACCGCTTCGACATCGTCCTGCGCGGGCAGCGTAAGACCTTCTTCGAGAACGCCTGA
Protein Properties
Protein Residues: 239
Protein Molecular Weight: 27.1 kDa
Protein Theoretical pI: 9.3
Hydropathicity (GRAVY score): -0.548
Charge at pH 7 (predicted): 6.33
Protein Sequence:
>PA0153
MHDAESRRFVIRDRNWHPKALTPDYKTSVPRSPSQALVSIPQSLSETSGPDFSHLRLGRHDNDLLLNFDHGGLPQGERIIMFGRVFDQYGKPVPHTLVEMWQANAGGRYRHKNDRYLAPLDPNFGGVGRTLTDSEGHYYFRTIKPGPYPWRNGPNDWRPAHIHVSVSGPAIAARLVTQMYFEGDPLIPKCPIIRTLADPEAAQSLIGRLDMSMANPMDCLAYRFDIVLRGQRKTFFENA
References
External Links:
Resource Link
Genome ID: PA0153
Entrez Gene ID: 878130
NCBI Protein ID: 15595351
General Reference: PaperBLAST - Find papers about PA0153 and its homologs