| Identification |
| Name: |
Alkyl hydroperoxide reductase subunit C |
| Synonyms: |
- Alkyl hydroperoxide reductase protein C22
- Peroxiredoxin
- SCRP-23
- Sulfate starvation-induced protein 8
- SSI8
- Thioredoxin peroxidase
|
| Gene Name: |
ahpC |
| Enzyme Class: |
|
| Biological Properties |
| General Function: |
Involved in peroxiredoxin activity |
| Specific Function: |
Directly reduces organic hydroperoxides in its reduced dithiol form |
| Cellular Location: |
Not Available |
| KEGG Pathways: |
|
| KEGG Reactions: |
|
2 Thiol-containing reductant | + | ROOH | ↔ | Oxidized thiol-containing reductant | + |  | + | ROH |
| 2 Thiol-containing reductant + ROOH ↔ Oxidized thiol-containing reductant + Water + ROH ReactionCard |
|
| SMPDB Reactions: |
Not Available |
| PseudoCyc/BioCyc Reactions: |
|
2 R'-SH | + | ROOH | → | R'-S-S-R' | + |  | + | ROH |
| | |
2 Thiol-containing reductant | + | ROOH | ↔ | Oxidized thiol-containing reductant | + |  | + | ROH |
| 2 Thiol-containing reductant + ROOH ↔ Oxidized thiol-containing reductant + Water + ROH ReactionCard | | an organic hydroperoxide + NADH + H + → an alcohol + NAD + + H 2O ReactionCard |
|
| Complex Reactions: |
|
2 R'-SH | + | ROOH | → | R'-S-S-R' | + |  | + | ROH |
| |
|
| Transports: |
Not Available |
| Metabolites: |
|
| GO Classification: |
| Function |
|---|
| antioxidant activity | | catalytic activity | | oxidoreductase activity | | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | | peroxiredoxin activity | | Process |
|---|
| cell redox homeostasis | | cellular homeostasis | | cellular process | | metabolic process | | oxidation reduction |
|
| Gene Properties |
| Locus tag: |
PA0139 |
| Strand: |
+ |
| Entrez Gene ID: |
879431 |
| Accession: |
NP_248829.1 |
| GI: |
15595337 |
| Sequence start: |
158199 |
| Sequence End: |
158762 |
| Sequence Length: |
563 |
| Gene Sequence: |
>PA0139
ATGTCCCTGATCAACACTCAAGTCCAACCGTTCAAGGTCAACGCTTTCCACAACGGCAAGTTCATCGAGGTGACCGAGGAATCCCTGAAGGGCAAGTGGTCGGTCCTGATCTTCATGCCGGCTGCCTTCACCTTCAACTGCCCGACCGAGATCGAAGACGCCGCCAACAACTACGGCGAGTTCCAGAAAGCCGGTGCCGAGGTCTACATCGTGACCACCGACACCCACTTCTCGCACAAGGTCTGGCACGAAACCTCCCCGGCAGTCGGCAAGGCCCAGTTCCCGCTGATCGGCGACCCGACCCACCAGCTGACCAACGCCTTCGGCGTGCACATCCCGGAAGAAGGCCTGGCCCTGCGCGGTACCTTCGTGATCAACCCGGAAGGCGTGATCAAGACCGTCGAGATCCACTCCAACGAGATCGCCCGTGACGTCGGCGAGACCGTGCGCAAGCTGAAGGCCGCCCAGTACACCGCCGCCCACCCGGGCGAAGTCTGCCCGGCCAAGTGGAAGGAAGGCGAGAAGACCCTCGCTCCGTCCCTGGACCTGGTCGGCAAGATCTAA |
| Protein Properties |
| Protein Residues: |
187 |
| Protein Molecular Weight: |
20.5 kDa |
| Protein Theoretical pI: |
6.3 |
| Hydropathicity (GRAVY score): |
-0.182 |
| Charge at pH 7 (predicted): |
-3.14 |
| Protein Sequence: |
>PA0139
MSLINTQVQPFKVNAFHNGKFIEVTEESLKGKWSVLIFMPAAFTFNCPTEIEDAANNYGEFQKAGAEVYIVTTDTHFSHKVWHETSPAVGKAQFPLIGDPTHQLTNAFGVHIPEEGLALRGTFVINPEGVIKTVEIHSNEIARDVGETVRKLKAAQYTAAHPGEVCPAKWKEGEKTLAPSLDLVGKI |
| References |
| External Links: |
|
| General Reference: |
PaperBLAST - Find papers about PA0139 and its homologs
|