Identification
Name: Tsi6
Synonyms: Not Available
Gene Name: tsi6
Enzyme Class: Not Available
Biological Properties
General Function: protein secretion by the type VI secretion system
Specific Function: toxin-antitoxin pair type II binding
Cellular Location: Unknown
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Function
    toxin-antitoxin pair type II binding
    Process
    protein secretion by the type VI secretion system
    Gene Properties
    Locus tag: PA0092
    Strand: -
    Entrez Gene ID: 880664
    Accession: NP_248782.1
    GI: 15595290
    Sequence start: 113022
    Sequence End: 113306
    Sequence Length: 284
    Gene Sequence:
    >PA0092
    ATGACACCCATCGAATACATCGACCGCGCTCTGGCGCTGGTCGTCGACCGGCTGGCCCGCTATCCGGGATACGAGGTCCTGCTGTCTGCGGAAAAGCAATTGCAGTACATCAGGTCCGTCCTGCTCGACCGCAGCCTGGATCGTTCCGCACTGCACCGGTTGACCCTCGGCAGCATCGCCGTGAAGGAATTCGACGAAACCGACCCGGAACTCTCCAGGGCCCTCAAGGACGCCTACTACGTCGGTATACGCACTGGCCGCGGCCTGAAGGTCGATCTGCCCTGA
    Protein Properties
    Protein Residues: 94
    Protein Molecular Weight: 10.7 kDa
    Protein Theoretical pI: 7.51
    Hydropathicity (GRAVY score): -0.126
    Charge at pH 7 (predicted): 0.22
    Protein Sequence:
    >PA0092
    MTPIEYIDRALALVVDRLARYPGYEVLLSAEKQLQYIRSVLLDRSLDRSALHRLTLGSIAVKEFDETDPELSRALKDAYYVGIRTGRGLKVDLP
    References
    External Links:
    Resource Link
    Genome ID: PA0092
    Entrez Gene ID: 880664
    NCBI Protein ID: 15595290
    General Reference: PaperBLAST - Find papers about PA0092 and its homologs